PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00641.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 334aa    MW: 37542.1 Da    PI: 8.5542
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00641.1_g00006.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.99.9e-54161431128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdeelvv+yLkk+v++ +l++ ++i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkat
  Sme2.5_00641.1_g00006.1  16 LPPGFRFHPTDEELVVHYLKKRVASVPLPV-SIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKAT 100
                              79****************************.89***************988899******************************** PP

                      NAM  87 gkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g+dk+vl++ ++++vg+kk Lvfy g+ pkg+kt+W+mheyrl
  Sme2.5_00641.1_g00006.1 101 GTDKPVLTAgGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRL 143
                              *******9977788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.06E-659176IPR003441NAC domain
PROSITE profilePS5100562.17716176IPR003441NAC domain
PfamPF023654.6E-2817143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009753Biological Processresponse to jasmonic acid
GO:0045995Biological Processregulation of embryonic development
GO:0048317Biological Processseed morphogenesis
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MESTDSSSGS HQQPQLPPGF RFHPTDEELV VHYLKKRVAS VPLPVSIIAE VDLYKFDPWE  60
LPAKATFGEQ EWYFFSPRDR KYPNGARPNR AATSGYWKAT GTDKPVLTAG GTQKVGVKKA  120
LVFYGGKPPK GVKTNWIMHE YRLAENKTNN KPPGCDLANK KSLRLDDWVL CRLYKKSNTQ  180
RAIDHERDDL NIDMMMGSSS INPSCIPMPN IFGQPKIPQL KSSNFGTTLL HENNQNLYEG  240
GSQFCTKRPL ANLYWNDEDG GGSNDNSQST KRFLSENMEE GTLNMNARTD EQNGSIVSLL  300
SQLPQTSSLH QQQVLGSLND GVFRQPYSAM NWYS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-741617815170Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00361DAPTransfer from AT3G15510Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF7019870.0JF701987.1 Solanum lycopersicum NAC3 mRNA, complete cds.
GenBankKC1430400.0KC143040.1 Solanum lycopersicum sinor-like protein 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001266277.20.0NAC domain transcription factor
SwissprotQ9LD441e-108NAC56_ARATH; NAC transcription factor 56
TrEMBLM1BP480.0M1BP48_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000496640.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18142466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.11e-109NAC domain containing protein 2